Intact logo

Java Software Development Senior - Commercial and Specialty Lines Auto

Intact
Department:Business Development
Type:HYBRID
Region:Montreal, Quebec
Location:Montreal, Quebec, Canada
Experience:Mid-Senior level
Estimated Salary:CAD90,000 - CAD130,000
Skills:
JAVAANGULARREACTNODEJSPYTHONXMLJSONRESTKUBERNETESOPENSHIFTAWSGCPDYNATRACEELKGITCICDJENKINSSONARQUBESASTDASTKAFKAMQNOSQLMONGODBELASTICSEARCHMICROSERVICESAPIDEVOPSSECURITYSRE
Share this job:

Job Description

Posted on: September 1, 2025

Our employees are at the heart of everything we do. Together, we help people, businesses, and society prosper in good times and be resilient in bad times. Our employee promise represents Intact’s commitment to you in exchange for living our Values, striving to do your best work, being open to change and investing in your career. In return, we promise to provide support, opportunities and performance-led financial rewards at a workplace where you can shape the future, win as a team and grow with us. About The Role We’re looking for a Software Development Senior to join our growing team! This is an exciting opportunity to revolutionize Intact Insurance's Commercial and Specialty Lines Auto policy management system. You will be a key player in modernizing the suite of tools used to manage CL Auto Quotes & Policies which will help to drive growth and profitability by delivering frictionless experiences for customers, brokers, and employees. If you are passionate about technology, business, problem-solving, and making a real impact, this is the place for you. What You'll Do Here

  • Develop high quality software systems to meet users' needs by finding solutions, solving complex problems, coding, testing, debugging, and documenting systems.
  • Ensure DevOps, Security, & SRE principles and practices are embedded into the team’s processes and ways of working.
  • Ensure sound application architecture, following Enterprise Architecture principles, patterns, and standards.
  • Guide, mentor, and coach the team members in various development and technical activities.
  • End-to-end accountability to deliver high-quality solutions by collaborating closely with end-users and business partners to iterate throughout the SDLC flow.
  • Provide deployment support for production systems to guarantee their functionality.
  • Ensure systems are optimal and meet quality standards by analyzing, providing suggestions, and developing assessments.
  • Demonstrate a strong Continuous Improvement mindset through actioning retrospectives and lessons learned on very frequent basis, contributing improvements in development as well as system maintenance processes.
  • Apply the SDLC (System Development Life Cycle) development methodology to ensure standards are met.
  • Be a guardian of code quality and secure coding by conducting thorough code reviews and holding developers to the highest standards.
  • Continuously optimize application performance and ensure scalability and reliability.
  • Create a collaborative environment through leading by example when interacting on a regular basis with colleagues across the country.
  • Re-engineer various monolithic and/or legacy CL Auto systems and move to IFC’s distributed core services architecture.

What You Bring To The Table

  • Degree in Computer Engineering / Science or any combination of equivalent education and experience.
  • 8-10 years of software design and development experience.
  • Excellent knowledge of and experience with Service Oriented Architecture, Microservices Architecture, Event Driven Architecture, Domain Driven Design, and Distributed Systems in general.
  • Experience and deep understanding of best practices in secure coding and application security.
  • Deep understanding of and experience with Object-Oriented design and development, as well as a solid understanding of UX design principles.
  • Significant software development experience as both a front-end and back-end developer, including database design and development, Angular/React, Node.js, Java, Hibernate, Python, XML, Json, REST.
  • Solid understanding and experience with API design, implementation, and lifecycle, as well as OpenAPI/Swagger specification.
  • Strong understanding of and experience with: Kubernetes (K8N), OpenShift platforms, AWS or GCP, Dynatrace, ELK, Git, CI/CD pipelines, Jenkins, SonarQube, SAST/DAST tools, Kafka, MQ, NoSQL (Mongo/Elasticsearch).
  • Solid understanding of Prompt Engineering and how to maximise the effectiveness of AI code assistants or agents.
  • Strong analytical mind, curious by nature, love to solve complex problems, attention to detail, and are passionate about providing the best experience possible to your users.
  • For candidates located in Quebec, bilingualism is required considering the necessity to interact on a regular basis with English-speaking colleagues across the country.
  • No Canadian work experience required however must be eligible to work in Canada.

What We Offer Our hybrid work model provides the balance between working from home and enjoying meaningful in-person interactions. Working Here Means You'll Be Empowered To Be And Do Your Best Every Day. Here Is Some Of What You Can Expect As a Permanent Member Of Our Team

  • A financial rewards program that recognizes your success
  • An industry leading Employee Share Purchase Plan; we match 50% of net shares purchased
  • An extensive flex pension and benefits package, with access to virtual healthcare
  • Flexible work arrangements
  • Possibility to purchase up to 5 extra days off per year
  • An annual wellness account that promotes an active and healthy lifestyle
  • Access to tools and resources to support physical and mental health, embracing change and connecting with colleagues
  • A dynamic workplace learning ecosystem complete with learning journeys, interactive online content, and inspiring programs
  • Inclusive employee-led networks to educate, inspire, amplify voices, build relationships and provide development opportunities
  • Inspiring leaders and colleagues who will lift you up and help you grow
  • A Community Impact program, because what you care about is a part of what makes you different. And how you contribute to your community should be just as unique.

We are an equal opportunity employer At Intact, our Value of respect is founded on seeing diversity as a strength. We strive to create an accessible workplace where employees feel valued, included and encouraged to share their unique perspectives. We encourage applications from individuals who are members of equity-deserving groups, including but not limited to women, Indigenous peoples, persons with disabilities, Black people, and members of the 2SLGBTQI+ community. As part of Intact’s commitment to reconciliation, we acknowledge that we work, meet and travel across the land currently called Canada, originally inhabited by First Nations, Metis and Inuit people. This history extends through many centuries and continues to evolve today. We have policies to ensure equal access and participation for people with disabilities, including providing workplace adjustments (accommodations). A copy of applicable policies is available on request. If we can provide a specific adjustment to make the recruitment process more accessible for you, please let us know when we reach out about a job opportunity. We’ll work with you to meet your needs. Learn more about our recruitment process and your candidate journey here. If you are an employee of Intact or belairdirect, please apply for this role on Internal Career Site.

Originally posted on LinkedIn

Apply now

Please let the company know that you found this position on our job board. This is a great way to support us, so we can keep posting cool jobs every day!

CanadaJobs.works logo

CanadaJobs.works

Get CanadaJobs.works on your phone!

SIMILAR JOBS
Co-operators logo

Associate Financial Advisor

Co-operators
2 days ago
Business Development
ON-SITE
Regina, Saskatchewan, Canada
LIFE INSURANCEWEALTH MANAGEMENTUNDERWRITING+2 more
Horizon Computer Solutions Inc. logo

Client Executive – Enterprise Sales

Horizon Computer Solutions Inc.
3 days ago
Business Development
ON-SITE
Saskatchewan, Canada
SALESRELATIONSHIP BUILDINGPROJECT MANAGEMENT+2 more
City of Regina logo

Internal Audit Specialist

City of Regina
3 days ago
Business Development
ON-SITE
Regina, Saskatchewan, Canada
INTERNAL AUDITRISK MANAGEMENTFINANCIAL SYSTEMS+5 more
IG Wealth Management logo

Coordinator Region Office Operations- Brossard QC

IG Wealth Management
4 days ago
Business Development
HYBRID
Québec, Quebec, Canada
MICROSOFT OFFICE 365MFDSTEAMS+3 more
Desjardins logo

Senior Advisor, Legal and regulatory compliance

Desjardins
4 days ago
Business Development
ON-SITE
Lévis, Quebec, Canada
LEGAL COMPLIANCEREGULATORY COMPLIANCERISK MANAGEMENT+3 more